DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Hoxb6

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_006247294.1 Gene:Hoxb6 / 497986 RGDID:1562142 Length:224 Species:Rattus norvegicus


Alignment Length:247 Identity:77/247 - (31%)
Similarity:97/247 - (39%) Gaps:62/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 NGAHPASTQSKSPNHSSSIPTYK--WMQLKRNVPKPQAPKLPA--SGIASMHDYQMNGQLDMCRG 431
            |...|.:..|...:....:|.|.  :....|:.|.|..|. |.  .|.|:...|...|      |
  Rat     7 NSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPG-PGQDKGFAASSYYPPAG------G 64

  Fly   432 GGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSA-------HPNGMGVGLGSGS 489
            |.|..:....||       :|          :......||.|.|.       ||...........
  Rat    65 GYGRAAPCDYGP-------AP----------AFYREKDAACALSGADEPPPFHPEPRKSDCAQDK 112

  Fly   490 G--------------------LSSCSLSS--NTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRI 532
            .                    ::||:.||  .:...||..:|..|..|||||||:||||||.|||
  Rat   113 SVFGETEEQKCSTPVYPWMQRMNSCNSSSFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRI 177

  Fly   533 EIANTLQLNETQVKIWFQNRRMKQKKRVKEGLIPADILTQHSTSVISEKPPQ 584
            |||:.|.|.|.|:||||||||||.||..|  |:.|   :|.|.....|||.:
  Rat   178 EIAHALCLTERQIKIWFQNRRMKWKKESK--LLSA---SQLSAEEEEEKPAE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 36/51 (71%)
Hoxb6XP_006247294.1 Homeobox 150..203 CDD:395001 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.