DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Hoxb7

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001017480.1 Gene:Hoxb7 / 497985 RGDID:1559918 Length:219 Species:Rattus norvegicus


Alignment Length:221 Identity:72/221 - (32%)
Similarity:87/221 - (39%) Gaps:58/221 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 VISPGS--STSSSTSASNGAHPASTQSKSPNHSSSIPTYKWMQLKRNVPKPQAPKLPASGIASMH 418
            |.:||:  ..:|...|||...|..........|:|:                      .|:.|  
  Rat    20 VFAPGAFPEQTSCAFASNPQRPGYGAGPGAPFSASV----------------------QGLYS-- 60

  Fly   419 DYQMNGQLDMCRGGGG--GGSGVGNGPVGVGGNGS----------PGIGGVLSVQNSLIMANSAA 471
                        ||||  |.|..|....|.|...|          ..:.||..       .:.|.
  Rat    61 ------------GGGGMAGQSAAGVYEAGYGLEPSSFNMHCAPFEQNLSGVCP-------GDPAK 106

  Fly   472 AAGSAHPNGMGVGLGSGSGLSSCSLSSNTNNS-GRTNFTNKQLTELEKEFHFNRYLTRARRIEIA 535
            |||:.......:...|...:.....||.|... ||..:|..|..|||||||:||||||.||||||
  Rat   107 AAGAKEQRDSDLAAESNFRIYPWMRSSGTERKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIA 171

  Fly   536 NTLQLNETQVKIWFQNRRMKQKKRVK 561
            :.|.|.|.|:||||||||||.||..|
  Rat   172 HALCLTERQIKIWFQNRRMKWKKENK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 36/51 (71%)
Hoxb7NP_001017480.1 Antp-type hexapeptide 126..131 0/4 (0%)
Homeobox 141..193 CDD:278475 36/51 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..219 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.