DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and hoxc8a

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001005771.1 Gene:hoxc8a / 449648 ZFINID:ZDB-GENE-990415-114 Length:250 Species:Danio rerio


Alignment Length:370 Identity:77/370 - (20%)
Similarity:102/370 - (27%) Gaps:189/370 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 TNLDCMYP--TAQAQAPVHGYAGQIEEKYAAVLHASYAPGMVLEDQDPMMQQATQSQMWHHQQHL 271
            |..||.:|  .|::...|:|             |.:.|||.    |.|.          ||.|..
Zfish    22 TYYDCRFPQSVARSHTLVYG-------------HGAAAPGF----QHPS----------HHVQDF 59

  Fly   272 AGSYALDAMDSLGMHAHMHHGLPHGHLGNLANNPHQQQP----------QVQQQQQQPHQQPQHP 326
                             .|||..     .::|..:||.|          :....:..|.|.....
Zfish    60 -----------------FHHGTT-----GISNPGYQQNPCALACHGDATKFYGYEALPRQPLYGT 102

  Fly   327 QNQSPAAHQQHHQNSVSPNGGMNRQQRGGVISPGSSTSSSTSASNGAHPASTQSKSPNHSSSIPT 391
            |.::..|..                       |...:|:||      :|...|.....:||....
Zfish   103 QQEATLAQY-----------------------PDCKSSNST------NPGEGQGHLSQNSSPSLM 138

  Fly   392 YKWMQLKRNVPKPQAPKLPASGIASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGG 456
            :.||       :|.||                                                 
Zfish   139 FPWM-------RPHAP------------------------------------------------- 147

  Fly   457 VLSVQNSLIMANSAAAAGSAHPNGMGVGLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEKEFH 521
                                                       ...:||..::..|..||||||.
Zfish   148 -------------------------------------------GRRNGRQTYSRYQTLELEKEFL 169

  Fly   522 FNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVKEGLIP 566
            ||.||||.||||:::.|.|.|.||||||||||||.||...:...|
Zfish   170 FNPYLTRKRRIEVSHALSLTERQVKIWFQNRRMKWKKENNKDKFP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 33/51 (65%)
hoxc8aNP_001005771.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..152 13/144 (9%)
Antp-type hexapeptide. /evidence=ECO:0000255 138..143 2/11 (18%)
Homeobox 153..205 CDD:278475 33/51 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..250 2/9 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.