DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and meox1

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001002450.2 Gene:meox1 / 436723 ZFINID:ZDB-GENE-040718-149 Length:253 Species:Danio rerio


Alignment Length:341 Identity:89/341 - (26%)
Similarity:116/341 - (34%) Gaps:120/341 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 PH--GHLGNLANNPHQ--QQPQVQQQQQQPHQQPQHPQNQSPAAHQQHHQNSVSPNGGMNRQQRG 354
            ||  |.|.....:||.  ....:|..||.|.           |.||:|                 
Zfish    12 PHTGGALWGCVRSPHSGGSGAGIQPYQQAPF-----------ALHQKH----------------- 48

  Fly   355 GVISPGSSTSSSTSASNGAHPASTQSKSPNHSSSIPTYKWMQLKRNVPKPQAPKLPASGIASMHD 419
            ..::....:||....:..|:|...:.....||....| :| |.....|:.:..: |..|.|....
Zfish    49 DFLAYTDFSSSCLVPAPHAYPREDRLYPETHSGYQRT-EW-QFSPCEPRGRGQE-PCQGAAEAVG 110

  Fly   420 YQMNGQLDMCRGGGGGGSGVGNGPVG-VGGNGSPGI--------------GGVLSVQNSLIMANS 469
            .:|:         ..||..:.....| :.|:.||..              ..|..:|:|...|:|
Zfish   111 AEMD---------SAGGDRLAGAVTGCLEGDYSPQSVPAVDTEKKSSKRKREVTDIQDSSFKADS 166

  Fly   470 AAAAGSAHPNGMGVGLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEI 534
            ...|                            ...||.||.:||.|||.||..:.||||.||.||
Zfish   167 NCKA----------------------------RKERTAFTKEQLRELEAEFTHHNYLTRLRRYEI 203

  Fly   535 ANTLQLNETQVKIWFQNRRMKQKKRVKEGLIPADILTQHSTSVISEKPPQQQQPQPPELQLKSQG 599
            |..|.|.|.|||:||||||||. ||||.|                       ||..|.       
Zfish   204 AVNLDLTERQVKVWFQNRRMKW-KRVKGG-----------------------QPASPH------- 237

  Fly   600 SDLGGNELATGA-PST 614
             ||..:||.:.| ||:
Zfish   238 -DLEADELDSAASPSS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 34/51 (67%)
meox1NP_001002450.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..158 1/21 (5%)
Homeobox 174..226 CDD:278475 34/52 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..253 15/58 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.