DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and MEOX1

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_004518.1 Gene:MEOX1 / 4222 HGNCID:7013 Length:254 Species:Homo sapiens


Alignment Length:243 Identity:77/243 - (31%)
Similarity:92/243 - (37%) Gaps:76/243 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 HPASTQSKSPNHSSSIPTYKWMQLKRNVPKPQAPKLPASGIASMHDYQMNGQLDMCRGGGGGGSG 438
            |||..|  |||         |     :.|...|.:.|.||.|                  ||...
Human    85 HPAFPQ--SPN---------W-----HFPVSDARRRPNSGPA------------------GGSKE 115

  Fly   439 VGNGPVG-VGGNGSPGIG-GVLSVQNSLIMANSAAAAGSAHPNGMGVGLGSGSGLSSCSLSSNTN 501
            :|...:| |...|.||.. |||....:.....|:.....:..|....|...||..:         
Human   116 MGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKA--------- 171

  Fly   502 NSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVKEGLIP 566
            ...||.||.:||.|||.||..:.||||.||.|||..|.|:|.|||:||||||||. ||||.|   
Human   172 RKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKW-KRVKGG--- 232

  Fly   567 ADILTQHSTSVISEKPPQQQQPQPPELQLKSQGSDLGGNELATGAPST 614
                                ||..|..|....|.       :|.:||:
Human   233 --------------------QPISPNGQDPEDGD-------STASPSS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 34/51 (67%)
MEOX1NP_004518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..178 31/134 (23%)
Homeobox 175..227 CDD:306543 34/52 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..254 13/57 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.