DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Ubx

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:411 Identity:107/411 - (26%)
Similarity:143/411 - (34%) Gaps:126/411 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 QQATQSQMWHHQQHLAGSYALDAMDSLGMH-------AHMHHGLPHGHLGNLANNPHQQQPQVQQ 314
            :||  |..:.|.....|.    ||.|.|.|       |..:.|.|.    :|..:|:......:.
  Fly     6 EQA--SGFYGHPHQATGM----AMGSGGHHDQTASAAAAAYRGFPL----SLGMSPYANHHLQRT 60

  Fly   315 QQQQPHQQP-----QHPQNQSPAAHQQHHQN----------SVSPNGGMNRQQRGGVISPGSSTS 364
            .|..|:...     .........|::|...|          .:...||.|....||....|....
  Fly    61 TQDSPYDASITAACNKIYGDGAGAYKQDCLNIKADAVNGYKDIWNTGGSNGGGGGGGGGGGGGAG 125

  Fly   365 SSTSA--SNGAHPASTQSKSPNHSSSIPTYKWMQLKRNVPKPQAPKLPASGIASMHDYQMNGQLD 427
            .:..|  :||.:.|:...                  :|.|....|..|:   |...|.::.|.||
  Fly   126 GTGGAGNANGGNAANANG------------------QNNPAGGMPVRPS---ACTPDSRVGGYLD 169

  Fly   428 MC-------RGGGGGG----SGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSA----AAAGSAH 477
            ..       |||..||    || |||..| |.....|:.|..:..|:....:.|    |||.|.|
  Fly   170 TSGGSPVSHRGGSAGGNVSVSG-GNGNAG-GVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLH 232

  Fly   478 P--------------------------------NGMGVGLG-------SGSGLSSCSLSSNTNNS 503
            .                                .|:...:|       :||.|.....::.....
  Fly   233 QASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRR 297

  Fly   504 GRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVKEGLIPAD 568
            ||..:|..|..|||||||.|.||||.||||:|:.|.|.|.|:||||||||||.||.::       
  Fly   298 GRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQ------- 355

  Fly   569 ILTQHSTSVISEKPPQQQQPQ 589
                    .|.|...|::|.|
  Fly   356 --------AIKELNEQEKQAQ 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 34/51 (67%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.