DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and ems

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster


Alignment Length:394 Identity:96/394 - (24%)
Similarity:130/394 - (32%) Gaps:155/394 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 HGLPHGHLGNLANNPHQQQPQVQQQQQQPHQQP--QHPQNQSPAAHQQH---------------- 337
            ||||:.|       ||.||..:|.....||..|  ||..:|.....|||                
  Fly    89 HGLPYPH-------PHAQQQHLQAPHPHPHLSPAQQHVLHQHLLMQQQHPGTPKSHQDIQELLQR 146

  Fly   338 -HQNSVSPNGGMNRQQRGGVISPGSS------------TSSSTSASNGAHPA------------- 376
             |.|:...:|....|.|   :||.:.            :.:..:.....:||             
  Fly   147 LHHNAAMASGLSPLQTR---LSPETEQPQMAVSLKRERSPAPPAMEQAENPAQRIQPPHTPPKSV 208

  Fly   377 STQSKSPNHSSSI---------PTYKWMQLKRNVPKPQAPKLPASGIASMHDYQMNGQLDMCRGG 432
            |.||..|:.|.::         |..:..|...|.|||          |.||.             
  Fly   209 SPQSSQPSSSPTLLISSPHATPPQQQQQQPPPNYPKP----------AMMHP------------- 250

  Fly   433 GGGGSGVGNG----------PVGVGG----NGSPGIGGV------------LSVQNS--LIMA-- 467
            ||.|..:..|          |:|.||    .|.||:..:            |..|::  ||.|  
  Fly   251 GGAGPMMMPGMPPAGLVRPFPMGPGGPPMPQGQPGLPDIKALPPYINAPPELPPQHNPHLIAAAQ 315

  Fly   468 -NSAAAAGSAHPNGMGVGLGSGSGLSSCSLSSNTN----------------NSG----------- 504
             ..|||..:.|..|......:.:||...:.....|                ..|           
  Fly   316 FQMAAALQAGHVLGPAAAAAAAAGLPPHAAQFMPNPGMARDSYQLYPWLLSRHGRIFPHRFPGSF 380

  Fly   505 -----------RTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKK 558
                       ||.|:..||.:||..|..|:|:..|.|..:|..|.|:|||||:||||||.|.|:
  Fly   381 LVPPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKR 445

  Fly   559 RVKE 562
            ..:|
  Fly   446 MQQE 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 27/51 (53%)
emsNP_731868.1 Homeobox 392..444 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I4021
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
44.060

Return to query results.
Submit another query.