DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and emx1

DIOPT Version :10

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_937787.1 Gene:emx1 / 378964 ZFINID:ZDB-GENE-031007-7 Length:231 Species:Danio rerio


Alignment Length:96 Identity:34/96 - (35%)
Similarity:48/96 - (50%) Gaps:25/96 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   505 RTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVKEGLIPADI 569
            ||.|:..||..||:.|..|.|:..|.|.::||:|.|:|||||:||||||.|.|:           
Zfish   137 RTAFSPSQLLRLERAFEKNHYVVGAERKQLANSLSLSETQVKVWFQNRRTKYKR----------- 190

  Fly   570 LTQHSTSVISEKPPQQQQPQPPELQLKSQGS 600
                          |:.:.:.||...|.:|:
Zfish   191 --------------QKLEEEGPECTQKKKGN 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeodomain 505..558 CDD:459649 28/52 (54%)
emx1NP_937787.1 Homeodomain 134..190 CDD:459649 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..231 4/15 (27%)

Return to query results.
Submit another query.