DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and PDX1

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_000200.1 Gene:PDX1 / 3651 HGNCID:6107 Length:283 Species:Homo sapiens


Alignment Length:282 Identity:78/282 - (27%)
Similarity:111/282 - (39%) Gaps:76/282 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 ASTQSKSPNHSSSIPTYKWMQLKRNVPKP---------------------QAPKL---PASGIAS 416
            |..:..:|..|:|.|...:|..:...|.|                     :.|.|   ||  :|.
Human    19 AFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEVPPLADDPA--VAH 81

  Fly   417 MHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSAHP-NG 480
            :| :.:..||           .:.:.|.|....|:.  .|||...|.:.:......:..||. .|
Human    82 LH-HHLPAQL-----------ALPHPPAGPFPEGAE--PGVLEEPNRVQLPFPWMKSTKAHAWKG 132

  Fly   481 MGVGLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQV 545
            ...|       .:.:.....|...||.:|..||.||||||.||:|::|.||:|:|..|.|.|..:
Human   133 QWAG-------GAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHI 190

  Fly   546 KIWFQNRRMKQKKR--VKEGLIPADILTQHSTSV----ISEKPPQQQQPQPPELQLKSQGSDLGG 604
            ||||||||||.||.  .|.|         ..|:|    ::|  |:|.       ...:.|.:|  
Human   191 KIWFQNRRMKWKKEEDKKRG---------GGTAVGGGGVAE--PEQD-------CAVTSGEEL-- 235

  Fly   605 NELATGAPSTPTTAMTLTAPTS 626
              ||...|..|..|:...||.:
Human   236 --LALPPPPPPGGAVPPAAPVA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 32/51 (63%)
PDX1NP_000200.1 Transactivation domain. /evidence=ECO:0000250 13..73 9/53 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..71 3/36 (8%)
Antp-type hexapeptide 118..123 0/4 (0%)
Homeobox 149..202 CDD:278475 32/52 (62%)
Nuclear localization signal. /evidence=ECO:0000250 197..203 4/5 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..283 18/77 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.