DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Gsx2

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001131035.2 Gene:Gsx2 / 364140 RGDID:1308047 Length:305 Species:Rattus norvegicus


Alignment Length:262 Identity:77/262 - (29%)
Similarity:100/262 - (38%) Gaps:83/262 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 NGAHPASTQSKS-PNHSSSIPTYKWMQLKRNVPKPQAPKLPASGIASMHDYQMNGQLDMC----- 429
            :.:.||.:..:| |.....||.        .:|.|....:...|..|    :.:|...:|     
  Rat    14 DSSRPAPSLPESHPGPDFFIPL--------GMPSPLVMSVSGPGCPS----RKSGAFCVCPLCVT 66

  Fly   430 ---------RGGGGGGSGVGNGPV---GV-GGNG---------SPGIG----------------- 455
                     .|.|||.:|.....|   || ||.|         |||.|                 
  Rat    67 SHLHSSRPPAGAGGGATGTAGAAVAGGGVAGGTGALPLLKSQFSPGPGDAQFCPRVSHAHHHHHA 131

  Fly   456 -------------GVLSVQNSLIMANSAAAAGSAHP-NGMGVGLGSGSGLSS-----CSLSSNTN 501
                         |..:...:...|.:||||...|| :...|...:...:|.     |.....::
  Rat   132 PQHHHHHHQPQQPGSAAAAAAAAAAAAAAAAALGHPQHHAPVCAATTYNVSDPRRFHCLTMGGSD 196

  Fly   502 NSG-------RTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKR 559
            .|.       ||.||:.||.|||:||..|.||:|.||||||..|.|:|.||||||||||:|.||.
  Rat   197 TSQVPNGKRMRTAFTSTQLLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKE 261

  Fly   560 VK 561
            .|
  Rat   262 GK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 35/51 (69%)
Gsx2NP_001131035.2 Homeobox 207..260 CDD:395001 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.