DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Meox1

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001102307.1 Gene:Meox1 / 363684 RGDID:1308911 Length:253 Species:Rattus norvegicus


Alignment Length:251 Identity:77/251 - (30%)
Similarity:105/251 - (41%) Gaps:60/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 SSSTSASNGAH----PASTQSKS--------PNHSS--------SIPTYKWMQLKRNVPKPQAP- 407
            |..:|||...|    |.|...||        |:.|:        |:|..:.:..:::...||.| 
  Rat    27 SEGSSASGLPHYPPTPFSFHQKSDFPATAAYPDFSTSCLAATPHSLPRAERIFNEQHPAFPQTPD 91

  Fly   408 -KLPASGIASMHDYQMN-GQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSA 470
             ..|.|....    ::| |.....|..|.|..|:.:|..|:|.:..  :.|.::.:....::...
  Rat    92 WHFPISEAGQ----RLNLGPAGSAREMGAGSPGLVDGTGGLGEDCM--VLGTIAHETEKKLSRRK 150

  Fly   471 AAAGSAHPNGMGVGLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIA 535
            ........||.|...||...           ...||.||.:||.|||.||..:.||||.||.|||
  Rat   151 KERSDNPENGGGKPEGSSKA-----------RKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIA 204

  Fly   536 NTLQLNETQVKIWFQNRRMKQKKRVKEGLIPADILTQHSTSVISEKP--PQQQQPQ 589
            ..|.|:|.|||:||||||||. ||||.|                 :|  ||:|.|:
  Rat   205 VNLDLSERQVKVWFQNRRMKW-KRVKGG-----------------QPVSPQEQDPE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 34/51 (67%)
Meox1NP_001102307.1 COG5576 139..251 CDD:227863 49/133 (37%)
Homeobox 174..227 CDD:395001 34/53 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.