DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and H2.0

DIOPT Version :10

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster


Alignment Length:36 Identity:9/36 - (25%)
Similarity:11/36 - (30%) Gaps:13/36 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PKPGTTAPQCPGGMTYSG------------IPVLCD 81
            ||| ....||.....:.|            :|..||
  Fly   319 PKP-YKCDQCSSAFRFRGALRSHKLLHQKDLPFRCD 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeodomain 505..558 CDD:459649
H2.0NP_523488.2 Homeodomain 292..352 CDD:459649 7/33 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.