DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and HOXD3

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_008829.3 Gene:HOXD3 / 3232 HGNCID:5137 Length:432 Species:Homo sapiens


Alignment Length:567 Identity:131/567 - (23%)
Similarity:167/567 - (29%) Gaps:292/567 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 QQQQQA--------QQQQLYPHSHLFSPSAAEYGITTSTTTGNPGTPLHPSSHSPADSYYESDSV 158
            :|.|||        |:...|.:..||    ..||.:.:|.|....||     |.|          
Human     4 EQGQQALELPECTMQKAAYYENPGLF----GGYGYSKTTDTYGYSTP-----HQP---------- 49

  Fly   159 HSYYATAAVATVAPPSNSSPITAANASATSNTQQQQQQAAIISSENGMMYTNLDCMYP----TAQ 219
                       ..||:.:|                                :||..||    :.|
Human    50 -----------YPPPAAAS--------------------------------SLDTDYPGSACSIQ 71

  Fly   220 AQAPVHGYAGQIEEKYAAVLHASYAPGMVLEDQDPMMQQATQSQMWHHQQHLAGSYALDAMDSLG 284
            :.||:.                  ||.                   |....|.||.         
Human    72 SSAPLR------------------APA-------------------HKGAELNGSC--------- 90

  Fly   285 MHAHMHHGLPHGHLGNLANNPHQQQPQVQQQQQQPHQQPQHPQNQSPAAHQQHHQNSVSPNGGM- 348
                |..|     .||........||.....:|||.|.|..|....|:       :..:|.||: 
Human    91 ----MRPG-----TGNSQGGGGGSQPPGLNSEQQPPQPPPPPPTLPPS-------SPTNPGGGVP 139

  Fly   349 NRQQRGGVISPGSSTSSSTSASNGAHPASTQSKSPNHSSSIPTYKWMQLKRNVPKPQAPKLPASG 413
            .::.:||   |.:|:||:|.:..                   .:.||:..|              
Human   140 AKKPKGG---PNASSSSATISKQ-------------------IFPWMKESR-------------- 168

  Fly   414 IASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSAHP 478
                                                           |||. ..||.|.||    
Human   169 -----------------------------------------------QNSK-QKNSCATAG---- 181

  Fly   479 NGMGVGLGSGSGLSSCSLSSNTNNSG---RTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQL 540
                         .||...|....:.   ||.:|:.||.||||||||||||.|.||:|:||.|.|
Human   182 -------------ESCEDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNL 233

  Fly   541 NETQVKIWFQNRRMKQKKRVK-EGLIPADILTQHSTSVISEKPPQQQQPQ--PPELQLKSQGSDL 602
            .|.|:||||||||||.||..| :|::       ||        |..|.|:  ||          |
Human   234 TERQIKIWFQNRRMKYKKDQKAKGIL-------HS--------PASQSPERSPP----------L 273

  Fly   603 GGNE--------------LATGAPSTPTTAMT---------LTAPTS 626
            ||..              ||..|||.|..|.:         .|||.|
Human   274 GGAAGHVAYSGQLPPVPGLAYDAPSPPAFAKSQPNMYGLAAYTAPLS 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 37/51 (73%)
HOXD3NP_008829.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..62 9/76 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..197 46/291 (16%)
Antp-type hexapeptide 160..165 1/4 (25%)
Homeobox 198..250 CDD:306543 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..280 12/51 (24%)
DUF4074 369..430 CDD:315871
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..432
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.