DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and HOXD1

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_078777.1 Gene:HOXD1 / 3231 HGNCID:5132 Length:328 Species:Homo sapiens


Alignment Length:284 Identity:96/284 - (33%)
Similarity:121/284 - (42%) Gaps:50/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 GGVISPGSSTSSSTSASNGAHPASTQSKSPNHSSSIPTYKWMQLKRNVPKPQAPKLPASG----- 413
            |..:|.....::..|.|..|.||......|    :.|.|....|:.......||...|.|     
Human    48 GAFVSCLPLAAARPSPSPPAAPARPSVPPP----AAPQYAQCTLEGAYEPGAAPAAAAGGADYGF 108

  Fly   414 IASMHDYQMNGQLDMCRGGG-------------GGGSGVGNGPVGVGGNGSPG-IGGVL--SVQN 462
            :.|...|...|.|......|             ||||.:.:|.|.....|.|| ....|  |...
Human   109 LGSGPAYDFPGVLGRAADDGGSHVHYATSAVFSGGGSFLLSGQVDYAAFGEPGPFPACLKASADG 173

  Fly   463 SLIMANSAAAAGSAHPNGMGVGLGSGSGLSS---CSLSSNTNNSG--------------RTNFTN 510
            ......:|:.|...:|..:....|..:..|:   ..:..|.:..|              ||||:.
Human   174 HPGAFQTASPAPGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFST 238

  Fly   511 KQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVKEGLIPADI------ 569
            |||||||||||||:||||||||||||.|.||:|||||||||||||||||.:|||:...|      
Human   239 KQLTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKREREGLLATAIPVAPLQ 303

  Fly   570 --LTQHSTSVISEKPPQQQQPQPP 591
              |:..:.:...:.|....|.|.|
Human   304 LPLSGTTPTKFIKNPGSPSQSQEP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 45/51 (88%)
HOXD1NP_078777.1 Antp-type hexapeptide 204..209 0/4 (0%)
Homeobox 233..285 CDD:278475 45/51 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..328 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41441
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45946
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2567
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.