DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and HOXC8

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_073149.1 Gene:HOXC8 / 3224 HGNCID:5129 Length:242 Species:Homo sapiens


Alignment Length:408 Identity:83/408 - (20%)
Similarity:120/408 - (29%) Gaps:208/408 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 DCMYP--TAQAQAPVHGYAGQIEEKYAAVLHASYAPGMVLEDQDPMMQQATQSQMWHHQQHLAGS 274
            ||.:|  ..::.|.|:|..|.             |||         .|.|:     ||.|..   
Human    25 DCRFPQSVGRSHALVYGPGGS-------------APG---------FQHAS-----HHVQDF--- 59

  Fly   275 YALDAMDSLGMHAHMHHGLPHGHLGNLANNPHQQQPQVQQQQQQPHQQPQHPQNQSPAAHQQHHQ 339
                          .|||     ...::|:.:||.|                             
Human    60 --------------FHHG-----TSGISNSGYQQNP----------------------------- 76

  Fly   340 NSVSPNGGMNR---------------QQRGGVIS-PGSSTSSSTSASNGAHPASTQSKSPNHSSS 388
            .|:|.:|..::               ||...|:. |...:|::|::|.|      |.....:||.
Human    77 CSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEG------QGHLNQNSSP 135

  Fly   389 IPTYKWMQLKRNVPKPQAPKLPASGIASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPG 453
            ...:.||       :|.||                                              
Human   136 SLMFPWM-------RPHAP---------------------------------------------- 147

  Fly   454 IGGVLSVQNSLIMANSAAAAGSAHPNGMGVGLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEK 518
                                                          ...|||..::..|..||||
Human   148 ----------------------------------------------GRRSGRQTYSRYQTLELEK 166

  Fly   519 EFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVKEGLIPADILTQHSTSVISEKPP 583
            ||.||.||||.||||:::.|.|.|.||||||||||||.||...:..:|.    ......:.|:..
Human   167 EFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPG----ARDEEKVEEEGN 227

  Fly   584 QQQQPQPPELQLKSQGSD 601
            ::::.:..|   |.:..|
Human   228 EEEEKEEEE---KEENKD 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 33/51 (65%)
HOXC8NP_073149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..154 14/144 (10%)
Antp-type hexapeptide 138..143 2/11 (18%)
Homeobox 153..205 CDD:306543 33/51 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..242 5/42 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.