DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and HOXC4

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_055435.2 Gene:HOXC4 / 3221 HGNCID:5126 Length:264 Species:Homo sapiens


Alignment Length:330 Identity:82/330 - (24%)
Similarity:109/330 - (33%) Gaps:143/330 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 QVQQQQQQPHQQPQHPQNQSPAAHQQHHQNSVSP-----------------NGGMNRQQRG---- 354
            :..|....|...|::......:..|.|||....|                 .|..|.:..|    
Human    22 EYSQNSYIPEHSPEYYGRTRESGFQHHHQELYPPPPPRPSYPERQYSCTSLQGPGNSRGHGPAQA 86

  Fly   355 GVISPGSSTS-------SSTSASNGAHPASTQSKSPNHSSSIPT-----YKWMQLKRNVPKPQAP 407
            |...|..|.|       |..|||....|.:....:|:|.||..:     |.||:           
Human    87 GHHHPEKSQSLCEPAPLSGASASPSPAPPACSQPAPDHPSSAASKQPIVYPWMK----------- 140

  Fly   408 KLPASGIASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAA 472
                    .:|...:|...              ||       |.|                    
Human   141 --------KIHVSTVNPNY--------------NG-------GEP-------------------- 156

  Fly   473 AGSAHPNGMGVGLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANT 537
                                         ...||.:|.:|:.|||||||:||||||.||||||::
Human   157 -----------------------------KRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHS 192

  Fly   538 LQLNETQVKIWFQNRRMKQKK-------RVKE----GLIPADILT-------QHSTSVISEKPPQ 584
            |.|:|.|:||||||||||.||       :|:.    |..|:.:..       .||.|.   .||:
Human   193 LCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSA---TPPE 254

  Fly   585 QQQPQ 589
            ||:.:
Human   255 QQRAE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 37/51 (73%)
HOXC4NP_055435.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..130 24/107 (22%)
Antp-type hexapeptide 135..140 2/4 (50%)
Homeobox 159..213 CDD:395001 37/53 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..264 10/49 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.