DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and HOXB8

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_076921.1 Gene:HOXB8 / 3218 HGNCID:5119 Length:243 Species:Homo sapiens


Alignment Length:270 Identity:73/270 - (27%)
Similarity:96/270 - (35%) Gaps:97/270 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 QQRGG----VISPGSSTSSSTSASNGAHPASTQS--KSPNHSSSIPTYKWMQLKRNVPKPQAPKL 409
            |..||    |..|.|..|..       ||:..|.  ..|:..|:.|                   
Human    30 QDLGGRPTVVYGPSSGGSFQ-------HPSQIQEFYHGPSSLSTAP------------------- 68

  Fly   410 PASGIASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPG-IGGVLSVQNSLIMANSAAAA 473
                      ||.|                   |..|..:|.|| ..|...:|...:.       
Human    69 ----------YQQN-------------------PCAVACHGDPGNFYGYDPLQRQSLF------- 97

  Fly   474 GSAHPNGMGVG---LGSGSGLSSCSLSSNTNNS------------------GRTNFTNKQLTELE 517
            |:..|:.:...   |.:.|||...:..|..:.|                  ||..::..|..|||
Human    98 GAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELE 162

  Fly   518 KEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVKEGLIPADILTQHSTSVISEKP 582
            |||.||.||||.||||:::.|.|.|.||||||||||||.||...:...|       |:....|:.
Human   163 KEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFP-------SSKCEQEEL 220

  Fly   583 PQQQQPQPPE 592
            .:|:..:.||
Human   221 EKQKLERAPE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 33/51 (65%)
HOXB8NP_076921.1 Antp-type hexapeptide 134..139 0/4 (0%)
Homeobox 150..203 CDD:395001 33/52 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..243 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.