DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and HOXB4

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_076920.1 Gene:HOXB4 / 3214 HGNCID:5115 Length:251 Species:Homo sapiens


Alignment Length:242 Identity:66/242 - (27%)
Similarity:83/242 - (34%) Gaps:103/242 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 PHQQPQHPQNQSPAAHQQHHQNSVSPNGGMNRQQRGGVISPGSSTSSSTSASNGAHPASTQSKSP 383
            |...|..|...||.|.......::.|..|    ||...:|  ||......|.|..||      ||
Human    79 PPPPPPPPPGLSPRAPAPPPAGALLPEPG----QRCEAVS--SSPPPPPCAQNPLHP------SP 131

  Fly   384 NHSS--SIPTYKWMQLKRNVPKPQAPKLPASGIASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGV 446
            :||:  ....|.||:                   .:|                            
Human   132 SHSACKEPVVYPWMR-------------------KVH---------------------------- 149

  Fly   447 GGNGSPGIGGVLSVQNSLIMANSAAAAGSAHPNGMGVGLGSGSGLSSCSLSSNTNNSGRTNFTNK 511
                                      ..:.:||..|                ......||.:|.:
Human   150 --------------------------VSTVNPNYAG----------------GEPKRSRTAYTRQ 172

  Fly   512 QLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKK 558
            |:.|||||||:||||||.||:|||:.|.|:|.|:||||||||||.||
Human   173 QVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 36/51 (71%)
HOXB4NP_076920.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..134 19/66 (29%)
Antp-type hexapeptide 141..146 2/4 (50%)
Homeobox 165..218 CDD:278475 36/52 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..251 66/242 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.