DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and MNX1

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_005506.3 Gene:MNX1 / 3110 HGNCID:4979 Length:401 Species:Homo sapiens


Alignment Length:347 Identity:95/347 - (27%)
Similarity:134/347 - (38%) Gaps:110/347 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 ISPGSSTSSSTSASNGAHPASTQSKSPNHSSSIPTYKWMQLKRNVPKPQAPKLPASGIASMHDYQ 421
            ::..:|.:.......||...::.|.|| .||..|.....:|:...|.|  |:|.|:..|.:....
Human    34 LAAAASGTGGGGGGGGASGGTSGSCSP-ASSEPPAAPADRLRAESPSP--PRLLAAHCALLPKPG 95

  Fly   422 MNGQLDMCRGGGGGGSGVGNG--------------------------PVGVGGNGSPGIGGVLSV 460
            ..|     .||||||:|.|:|                          .:|:...|:.| |..|..
Human    96 FLG-----AGGGGGGTGGGHGGPHHHAHPGAAAAAAAAAAAAAAGGLALGLHPGGAQG-GAGLPA 154

  Fly   461 QNSL----IMANSAAAAGSA-----------HPNGMG---------VGLGSGS------------ 489
            |.:|    :...|||||.:|           :|...|         :.||:|:            
Human   155 QAALYGHPVYGYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPIKLGAGTFQLDQWLRASTA 219

  Fly   490 -----GLSSCSLSSNTNNSG-----RTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQ 544
                 .:...:..:.:|..|     ||.||::||.|||.:|..|:||:|.:|.|:|.:|.|.|||
Human   220 GMILPKMPDFNSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQ 284

  Fly   545 VKIWFQNRRMKQKKRVKEGLIPADILTQHSTSVISEKPPQQQQPQPPELQLKSQGSDLGGNELAT 609
            |||||||||||.|:                     .|..::|..|..|   |.:|   ||.....
Human   285 VKIWFQNRRMKWKR---------------------SKKAKEQAAQEAE---KQKG---GGGGAGK 322

  Fly   610 GAPSTPTTAMTL--TAPTSKQS 629
            |....|.....|  .||..|.|
Human   323 GGAEEPGAEELLGPPAPGDKGS 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 33/51 (65%)
MNX1NP_005506.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..78 10/41 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..120 8/18 (44%)
Homeobox 244..297 CDD:278475 33/52 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..401 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.