DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and hoxc3a

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001128157.2 Gene:hoxc3a / 30421 ZFINID:ZDB-GENE-980526-532 Length:263 Species:Danio rerio


Alignment Length:95 Identity:42/95 - (44%)
Similarity:57/95 - (60%) Gaps:12/95 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   468 NSAAAAGSAHPNGMGVGLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRI 532
            |:..:..|.:.||..|            :.::::...|..||:.||.||||||||:.||.|.||:
Zfish   137 NAMESGDSKYSNGEAV------------VRNSSSKRARVAFTSSQLLELEKEFHFSAYLCRNRRL 189

  Fly   533 EIANTLQLNETQVKIWFQNRRMKQKKRVKE 562
            |:|..|:|.:.|:||||||||||.||..||
Zfish   190 EMAELLKLTDRQIKIWFQNRRMKYKKDHKE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 33/51 (65%)
hoxc3aNP_001128157.2 Abdominal-A 123..246 CDD:332641 42/95 (44%)
Homeobox 162..214 CDD:306543 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.