DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and hoxb8b

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_571256.1 Gene:hoxb8b / 30420 ZFINID:ZDB-GENE-980526-291 Length:247 Species:Danio rerio


Alignment Length:85 Identity:42/85 - (49%)
Similarity:50/85 - (58%) Gaps:7/85 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   504 GRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVKEGLIPAD 568
            ||..::..|..||||||.||.||||.||||:::.|.|.|.||||||||||||.||...:...|:.
Zfish   148 GRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKEHNKDKFPSS 212

  Fly   569 ILTQHST-------SVISEK 581
            ...|...       |.:|||
Zfish   213 KAEQEEIERERQEGSQVSEK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 33/51 (65%)
hoxb8bNP_571256.1 Antp-type hexapeptide 134..139
Homeobox 149..201 CDD:278475 33/51 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..247 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.