DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and hoxc5a

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_571219.2 Gene:hoxc5a / 30379 ZFINID:ZDB-GENE-980526-533 Length:233 Species:Danio rerio


Alignment Length:235 Identity:78/235 - (33%)
Similarity:98/235 - (41%) Gaps:49/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 SSTSSSTSASNGAHPASTQSK--------SPNHSSSIPTYKWMQLKRN-------------VPKP 404
            ||....|..:.|||....:|.        ..:.||.|||   ..|:|.             |.:.
Zfish    17 SSCRMHTFDNYGAHSEFHESNYAYEGLDLGGSFSSQIPT---NSLRREAINTTDRARSSAAVQRT 78

  Fly   405 QA-PKLPASGIASMHDYQ--MNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLI- 465
            |: ..|.:....|.|.|.  .:|.|..        ...||..|....:|......:.....|.| 
Zfish    79 QSCSALGSRSFVSTHGYNPLSHGLLSQ--------KAEGNMEVMEKPSGKSRTDDIKMETTSAIK 135

  Fly   466 -MANSAAAAGSAHPNGMGVGLGSGSGLSSCSLSSNTNNS-GRTNFTNKQLTELEKEFHFNRYLTR 528
             ..||......:.|.       ....::...:|..::.. .||::|..|..||||||||||||||
Zfish   136 QQTNSTQRQNQSQPQ-------IYPWMTKLHMSHESDGKRSRTSYTRYQTLELEKEFHFNRYLTR 193

  Fly   529 ARRIEIANTLQLNETQVKIWFQNRRMKQKK----RVKEGL 564
            .|||||||.|.|||.|:||||||||||.||    :||.||
Zfish   194 RRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKLKVKGGL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 40/51 (78%)
hoxc5aNP_571219.2 Homeobox 169..222 CDD:278475 40/52 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.