DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Hoxb3

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001100512.1 Gene:Hoxb3 / 303488 RGDID:1310780 Length:429 Species:Rattus norvegicus


Alignment Length:404 Identity:122/404 - (30%)
Similarity:153/404 - (37%) Gaps:135/404 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 AAVLHASYA--PGMVLEDQD----PMMQQATQSQMWHHQQHLAGSYALDA--MDSLGMHAHMHHG 292
            ||.|...|:  ||......|    |..|.||         ||.|.|...|  :.|||      :.
  Rat    11 AAALFGGYSSYPGSNGFGYDGPPQPPFQAAT---------HLEGDYQRSACSLQSLG------NA 60

  Fly   293 LPHGHLGNLANNPHQQQPQVQQQQQQPHQQPQHPQNQSPAAHQQHHQNSVSPNGGMNRQQRGGVI 357
            .||.....|  |....:|.:     .|...|..|.:..|:|                        
  Rat    61 APHAKSKEL--NGSCMRPGL-----APEPLPAPPGSPPPSA------------------------ 94

  Fly   358 SPGSSTSSSTSASNGAHPASTQ----SKSPNHSSSIPTYKWMQLKRNVPKPQAPKLPASGIASMH 418
            :|.|:||:|   :||..|:.:.    ..|.|.:.:...:.||:..|     |..||..|.     
  Rat    95 APTSTTSNS---NNGGGPSKSGPPKCGASSNSTLTKQIFPWMKESR-----QTSKLKNSS----- 146

  Fly   419 DYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSAHPNGMGV 483
                .|..:.|.||||||.|.|:..   ||.||.|.||..|                  |.|   
  Rat   147 ----PGTAEGCGGGGGGGGGGGSSS---GGGGSGGGGGDKS------------------PPG--- 183

  Fly   484 GLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIW 548
                          |..:...||.:|:.||.||||||||||||.|.||:|:||.|.|:|.|:|||
  Rat   184 --------------SAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIW 234

  Fly   549 FQNRRMKQKKRVK-EGLI-------PADILTQ--HST----SVISEKPPQQQQPQPPELQLKSQG 599
            |||||||.||..| :||.       ||....|  .||    :.:....|....|.||...     
  Rat   235 FQNRRMKYKKDQKAKGLASSSGGPSPAGSPPQPMQSTAGFMNALHSMTPSYDSPSPPAFS----- 294

  Fly   600 SDLGGNELATGAPS 613
               .|::.|...||
  Rat   295 ---KGHQNAYALPS 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 37/51 (73%)
Hoxb3NP_001100512.1 Homeobox 191..244 CDD:395001 37/52 (71%)
DUF4074 365..427 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.