DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and hoxb6a

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_571194.1 Gene:hoxb6a / 30341 ZFINID:ZDB-GENE-990415-106 Length:228 Species:Danio rerio


Alignment Length:217 Identity:66/217 - (30%)
Similarity:92/217 - (42%) Gaps:52/217 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 GGMNRQQRGGVISPGSSTSSSTSASNGAHPASTQSKSPNHSSSIPTYKWMQLKRNVPKPQAPKLP 410
            ||.:.|::       :..||....:|||:..:| :..|...::...|:             .|.|
Zfish    45 GGSSVQEK-------AYPSSFYQQANGAYSRAT-AAGPCDYATASFYR-------------EKDP 88

  Fly   411 ASGIASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGS 475
            |..:||:.::......|..:....|.:|....|                      .|:....:..
Zfish    89 ACALASIEEHSFVLSQDHRKTDCTGSTGKSIYP----------------------EADEQKPSAP 131

  Fly   476 AHPNGMGVGLGSGSGLSSCS-LSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQ 539
            .:|        ....::||: ...|....||..:|..|..||||||||||||||.||||||:.|.
Zfish   132 VYP--------WMQRMNSCNGTFGNAGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALC 188

  Fly   540 LNETQVKIWFQNRRMKQKKRVK 561
            |.|.|:||||||||||.||..|
Zfish   189 LTERQIKIWFQNRRMKWKKENK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 37/51 (73%)
hoxb6aNP_571194.1 Antp-type hexapeptide 132..137 1/12 (8%)
Homeobox 154..206 CDD:278475 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.