DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and hoxd4a

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001119917.1 Gene:hoxd4a / 30329 ZFINID:ZDB-GENE-980526-214 Length:256 Species:Danio rerio


Alignment Length:259 Identity:76/259 - (29%)
Similarity:103/259 - (39%) Gaps:76/259 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 QQHHQNSVSPNGGMNRQQRGGVISPGSSTSSSTSASNGAHPASTQSKSPN-----HSSSIPTYKW 394
            :::.|||..|      :|..|..||...|...   ..|.:..|..|:.|.     ..||:.....
Zfish    41 EEYSQNSYIP------EQSPGYYSPSQDTDFQ---HPGIYSRSNYSEQPYSCSTVQGSSVQPRGH 96

  Fly   395 MQLKRNVPKPQAPKLPASGIASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLS 459
            :|.:.:.|.|    .||             |.:.|..            |.:.|:.:.|......
Zfish    97 VQDQASTPSP----FPA-------------QTEQCPA------------VQISGSRTGGQQQNTK 132

  Fly   460 VQNSLIMANSAAA--------AGSAHPNGMGVGLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTEL 516
            .||.:.....|..        ..:.:|:..|                ......||.:|.:|:.||
Zfish   133 TQNGIPTKQPAVVYPWMKKVHVTTVNPDYTG----------------PEPKRSRTAYTRQQVLEL 181

  Fly   517 EKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVKEGLIP------ADILTQHS 574
            ||||||||||||.||||||:||.|:|.|:||||||||||.||..|   :|      |.:..||:
Zfish   182 EKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHK---LPNTKGRSASVGNQHA 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 39/51 (76%)
hoxd4aNP_001119917.1 Homeobox 169..222 CDD:278475 39/52 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.