DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and hoxa2b

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_571181.1 Gene:hoxa2b / 30325 ZFINID:ZDB-GENE-990415-98 Length:363 Species:Danio rerio


Alignment Length:323 Identity:84/323 - (26%)
Similarity:114/323 - (35%) Gaps:125/323 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 SSTSSST----------------SASNGAHPASTQSK-SPNHSSSIPT------YKWMQLKRNVP 402
            ||..|||                |.:.|:||..::.| :||.|..:|.      |.||:.|:...
Zfish    35 SSIKSSTLSHSTLIPPPFEQTIPSLNPGSHPRHSRPKQNPNGSCPLPAASLPPEYPWMKEKKASK 99

  Fly   403 KPQAPKLPASGIASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMA 467
            |.|.....|:                          ...||:.....|||.|.            
Zfish   100 KNQTTSTAAT--------------------------TDPGPLYFSPQGSPEIS------------ 126

  Fly   468 NSAAAAGSAHPNGMGVGLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRI 532
                              ..|||         .....||.:||.||.|||||||||:||.|.||:
Zfish   127 ------------------DGGSG---------ATRRLRTAYTNTQLLELEKEFHFNKYLCRPRRV 164

  Fly   533 EIANTLQLNETQVKIWFQNRRMKQKKRVK-------EGLIPA--------------DILTQHSTS 576
            |||..|.|.|.|||:||||||||.|::.:       :|..|:              :.:..:.:.
Zfish   165 EIAALLDLTERQVKVWFQNRRMKHKRQTQCKENHHGDGKPPSLEEAGGRGDGKSFFEQVANNVSG 229

  Fly   577 VISEKP--PQQQQPQPPELQLKSQGSD--------LGGNE-----LATGAPSTPTTAMTLTAP 624
            .:.|:.  |.||.....:.......||        ||.|:     ....:|:.|....|: ||
Zfish   230 ALLEREGYPFQQNTLTSQQSQNGHNSDSQSATVSPLGSNDKHLKHFPNPSPTVPICTTTM-AP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 37/51 (73%)
hoxa2bNP_571181.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..132 25/154 (16%)
Antp-type hexapeptide 88..93 2/4 (50%)
Homeobox 137..189 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..218 5/31 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..279 5/33 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.