DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Hoxd4

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001099355.1 Gene:Hoxd4 / 288153 RGDID:1309690 Length:251 Species:Rattus norvegicus


Alignment Length:256 Identity:80/256 - (31%)
Similarity:96/256 - (37%) Gaps:82/256 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 PKLPASGIASMHDYQMNGQLDMCRGG---GGGGSGVGNGPVGV----------GGNGSPGIGGVL 458
            ||.|     ...:|...|.|.. :|.   |.|..|....|.|:          .|.|.||.|..|
  Rat    15 PKFP-----PCEEYLQGGYLGE-QGADYYGSGAQGSDFQPPGLYPRPDFGEQPFGGGGPGPGSAL 73

  Fly   459 SVQNSLIMANSAAAAGSAHPNGMGVGLGSGS------------GLSSCSL--------------- 496
                       .|......|:|.|....:..            |..:||.               
  Rat    74 -----------PARGHGQEPSGPGSHYSAPGEPCPAPPPAPLPGARACSQPTGPKQPPPGTALKQ 127

  Fly   497 --------------SSNTNNSG------RTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLN 541
                          |.|.|.:|      ||.:|.:|:.||||||||||||||.||||||:||.|:
  Rat   128 PAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLS 192

  Fly   542 ETQVKIWFQNRRMKQKKRVKEGLIPADILTQHSTSVISEKPPQQQQPQPPELQLKSQGSDL 602
            |.|:||||||||||.||..|.........:..|:...|..|.|..||     ..|...:||
  Rat   193 ERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSCSSSAAPSQHLQP-----MAKDHHTDL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 39/51 (76%)
Hoxd4NP_001099355.1 Homeobox 155..209 CDD:395001 39/53 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.