DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Gbx1

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001258382.1 Gene:Gbx1 / 246149 RGDID:621864 Length:425 Species:Rattus norvegicus


Alignment Length:217 Identity:67/217 - (30%)
Similarity:100/217 - (46%) Gaps:32/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 SSTSSSTSASNGAHPASTQSKSPNHSSSIPTYKWMQLKRNVPKPQA-------PKLPASGIASMH 418
            ::.:|:.|.||...||.....:.:....:|..:.:......|.|..       |.|||.|.....
  Rat   186 AAAASTVSRSNPEPPARRTDGALDADELLPAREKVTEPPPPPPPPPPHFSETFPSLPAEGKVYSS 250

  Fly   419 DYQMNGQLDMCRGGGGG------GSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSAH 477
            |.:   :|:...|...|      ||| |:.......:.:.|.|.:|..:..|        .||  
  Rat   251 DEE---KLEPPAGEPAGSEPEEEGSG-GDSEDSFLDSSAGGPGALLGPKPKL--------KGS-- 301

  Fly   478 PNGMGVGLGSGSGLSS-CSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLN 541
               :|.|...|:.::: .:.....:...||.||::||.|||||||..:||:...|.:||:.|:|:
  Rat   302 ---LGTGAEEGTPVATGVTTPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLS 363

  Fly   542 ETQVKIWFQNRRMKQKKRVKEG 563
            |.||||||||||.|. ||:|.|
  Rat   364 EVQVKIWFQNRRAKW-KRIKAG 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 32/51 (63%)
Gbx1NP_001258382.1 Homeobox 326..379 CDD:278475 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.