DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Hoxc8

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001170797.2 Gene:Hoxc8 / 24460 RGDID:2821 Length:242 Species:Rattus norvegicus


Alignment Length:408 Identity:83/408 - (20%)
Similarity:120/408 - (29%) Gaps:208/408 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 DCMYP--TAQAQAPVHGYAGQIEEKYAAVLHASYAPGMVLEDQDPMMQQATQSQMWHHQQHLAGS 274
            ||.:|  ..::.|.|:|..|.             |||         .|.|:     ||.|..   
  Rat    25 DCRFPQSVGRSHALVYGPGGS-------------APG---------FQHAS-----HHVQDF--- 59

  Fly   275 YALDAMDSLGMHAHMHHGLPHGHLGNLANNPHQQQPQVQQQQQQPHQQPQHPQNQSPAAHQQHHQ 339
                          .|||     ...::|:.:||.|                             
  Rat    60 --------------FHHG-----TSGISNSGYQQNP----------------------------- 76

  Fly   340 NSVSPNGGMNR---------------QQRGGVIS-PGSSTSSSTSASNGAHPASTQSKSPNHSSS 388
            .|:|.:|..::               ||...|:. |...:|::|::|.|      |.....:||.
  Rat    77 CSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEG------QGHLNQNSSP 135

  Fly   389 IPTYKWMQLKRNVPKPQAPKLPASGIASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPG 453
            ...:.||       :|.||                                              
  Rat   136 SLMFPWM-------RPHAP---------------------------------------------- 147

  Fly   454 IGGVLSVQNSLIMANSAAAAGSAHPNGMGVGLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEK 518
                                                          ...|||..::..|..||||
  Rat   148 ----------------------------------------------GRRSGRQTYSRYQTLELEK 166

  Fly   519 EFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVKEGLIPADILTQHSTSVISEKPP 583
            ||.||.||||.||||:::.|.|.|.||||||||||||.||...:..:|.    ......:.|:..
  Rat   167 EFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPG----ARDEEKVEEEGN 227

  Fly   584 QQQQPQPPELQLKSQGSD 601
            ::::.:..|   |.:..|
  Rat   228 EEEEKEEEE---KEENKD 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 33/51 (65%)
Hoxc8NP_001170797.2 Homeobox 153..206 CDD:395001 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.