DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Vax2

DIOPT Version :10

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_036042.1 Gene:Vax2 / 24113 MGIID:1346018 Length:292 Species:Mus musculus


Alignment Length:150 Identity:46/150 - (30%)
Similarity:62/150 - (41%) Gaps:31/150 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 GGGGGGSGVGNGPVGV---GGNGSPGIGGVLSVQNSLIMANSAAAAGSAHPNGMGVGLGSGSGLS 492
            ||..|..|...|...:   .|:.||         ..:...::::.|||....|...|..:.....
Mouse    19 GGRSGRHGEHRGAEDLRADTGSASP---------REIAGTSASSPAGSRESGGDSDGQQALGETD 74

  Fly   493 SC-------------------SLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTL 538
            .|                   .|..:.....||:||.:||..||.||...:|:....|.|:|..|
Mouse    75 HCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQL 139

  Fly   539 QLNETQVKIWFQNRRMKQKK 558
            .|:|||||:||||||.||||
Mouse   140 NLSETQVKVWFQNRRTKQKK 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeodomain 505..558 CDD:459649 29/52 (56%)
Vax2NP_036042.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..74 13/63 (21%)
Homeodomain 103..159 CDD:459649 29/55 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..242
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.