DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and ceh-16

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001379631.1 Gene:ceh-16 / 191618 WormBaseID:WBGene00000439 Length:187 Species:Caenorhabditis elegans


Alignment Length:126 Identity:47/126 - (37%)
Similarity:62/126 - (49%) Gaps:7/126 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 PVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSAHPNGMGVGLGSGSGLSSCSLSSNTNNSGRTN 507
            |.....||:|.|..  |:..:.:.:...:...||.|..........:|.|.   ||......||.
 Worm    34 PTFASPNGTPNIAS--SMYPAWVFSTRYSDRPSAGPRHRKSRKRESTGSSG---SSEEEKRPRTA 93

  Fly   508 FTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVKEGLIPAD 568
            ||..||..|:.||..:||||..||.|:|:.|.|||:|:||||||:|.|.||....  :|.|
 Worm    94 FTGDQLDRLKTEFRESRYLTEKRRQELAHELGLNESQIKIWFQNKRAKLKKSTSS--VPRD 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 30/51 (59%)
ceh-16NP_001379631.1 Homeobox 90..144 CDD:395001 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I4021
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.