DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Pdx1

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_032840.1 Gene:Pdx1 / 18609 MGIID:102851 Length:284 Species:Mus musculus


Alignment Length:279 Identity:75/279 - (26%)
Similarity:101/279 - (36%) Gaps:95/279 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 PGSSTSSSTSASNGAHPASTQSKSPNHSSSIPTYKWMQLKRNVPKPQAPKLPASGIASMHDYQMN 423
            |...|||..|...|:.|            .|..|:       || |.|...||.  |.:| :.:.
Mouse    47 PPQFTSSLGSLEQGSPP------------DISPYE-------VP-PLASDDPAG--AHLH-HHLP 88

  Fly   424 GQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSAHP-NGMGVGLGS 487
            .||           |:.:.|.|...||:.  .|.|...|.:.:......:..||. .|...|   
Mouse    89 AQL-----------GLAHPPPGPFPNGTE--PGGLEEPNRVQLPFPWMKSTKAHAWKGQWAG--- 137

  Fly   488 GSGLSSCSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNR 552
                .:.:.....|...||.:|..||.||||||.||:|::|.||:|:|..|.|.|..:|||||||
Mouse   138 ----GAYTAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNR 198

  Fly   553 RMKQKKR---------------------------------------------------VKEGLIP 566
            |||.||.                                                   |:|||:|
Mouse   199 RMKWKKEEDKKRSSGTPSGGGGGEEPEQDCAVTSGEELLAVPPLPPPGGAVPPGVPAAVREGLLP 263

  Fly   567 ADILTQHSTSVISEKPPQQ 585
            :.:......|.|:...||:
Mouse   264 SGLSVSPQPSSIAPLRPQE 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 32/51 (63%)
Pdx1NP_032840.1 Transactivation domain. /evidence=ECO:0000250 13..73 11/45 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..116 27/104 (26%)
Antp-type hexapeptide 119..124 0/4 (0%)
Homeobox 150..203 CDD:278475 32/52 (62%)
Nuclear localization signal 198..204 4/5 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..284 11/81 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.