DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and ceh-13

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans


Alignment Length:275 Identity:78/275 - (28%)
Similarity:98/275 - (35%) Gaps:116/275 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 PHGHLGNLANNPHQQQPQVQQQQQQPHQQPQHPQNQSPAAHQ------QHHQNSVSPNGGMNRQQ 352
            ||        |.:|..|....      ..|..|.:.||..|.      .|..|.:..||.::...
 Worm    11 PH--------NYYQDWPTTHS------YYPSVPSSYSPLNHHPADIWAAHPSNYIMGNGHVSPPA 61

  Fly   353 RGGVISPGSSTSSSTSASNGAHPASTQSKSPNHSSSIPTYKWMQLKRNVPKPQAPKLPASGIASM 417
            ....:||.:|.||::||.   .|....:...|      |||||..||: .:|.|||         
 Worm    62 TASGLSPPASRSSNSSAE---LPTGVTASQHN------TYKWMHTKRS-QRPAAPK--------- 107

  Fly   418 HDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSAHPNGMG 482
                                                        ..:|                 
 Worm   108 --------------------------------------------KKVI----------------- 111

  Fly   483 VGLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKI 547
                            :.|.:.|||||..||||||||||..:|:.|.||.|||:.|:|.|.||||
 Worm   112 ----------------DENGTNRTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKI 160

  Fly   548 WFQNRRMKQKKRVKE 562
            ||||||||:|||.||
 Worm   161 WFQNRRMKEKKREKE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 37/51 (73%)
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 31/45 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I5355
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2567
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.