DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and ceh-7

DIOPT Version :10

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_495848.1 Gene:ceh-7 / 174391 WormBaseID:WBGene00000432 Length:84 Species:Caenorhabditis elegans


Alignment Length:58 Identity:25/58 - (43%)
Similarity:36/58 - (62%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   505 RTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVKE 562
            ||.||.:||..||..|..::|:....|..:|..|.|:|.||||||||||::.::...:
 Worm    27 RTTFTVEQLYLLEMYFAQSQYVGCDERERLARILSLDEYQVKIWFQNRRIRMRREANK 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeodomain 505..558 CDD:459649 25/52 (48%)
ceh-7NP_495848.1 Homeodomain 25..80 CDD:459649 25/52 (48%)

Return to query results.
Submit another query.