DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Hoxd3

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_034598.2 Gene:Hoxd3 / 15434 MGIID:96207 Length:433 Species:Mus musculus


Alignment Length:510 Identity:121/510 - (23%)
Similarity:151/510 - (29%) Gaps:243/510 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 SYYESDSVHSYY----ATAAVATVAPPSNSSPITAANASATSNTQQQQQQAAIISSENGMMYTNL 211
            :|||:..:...|    ||.......|.....|..|||                          :|
Mouse    21 AYYENPGLFGGYGYSKATDTYGYSTPHQPYPPPAAAN--------------------------SL 59

  Fly   212 DCMYPTA----QAQAPVHGYAGQIEEKYAAVLHASYAPGMVLEDQDPMMQQATQSQMWHHQQHLA 272
            |..||::    |:.||:.                  ||.                   |....|.
Mouse    60 DSDYPSSACSIQSSAPLR------------------APA-------------------HKGAELN 87

  Fly   273 GSYALDAMDSLGMHAHMHHGLPHGHLGNLANNPHQQQPQVQQQQQQPHQQPQHPQNQSPAAHQQH 337
            ||.             |..|..:...|...|.|    |.:..:||.|...|..|....|:     
Mouse    88 GSC-------------MRPGTGNSQGGGGGNQP----PGLNSEQQPPQPPPPPPPTLPPS----- 130

  Fly   338 HQNSVSPNGGMNRQQRGGVISPGSSTSSSTSASNGAHPASTQSKSPNHSSSIPTYKWMQLKRNVP 402
              :..:|..|:          |...|....|||:.   :||.||.        .:.||:..|   
Mouse   131 --SPTNPGSGV----------PAKKTKGGLSASSS---SSTISKQ--------IFPWMKESR--- 169

  Fly   403 KPQAPKLPASGIASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMA 467
                                                                      |||. ..
Mouse   170 ----------------------------------------------------------QNSK-QK 175

  Fly   468 NSAAAAGSAHPNGMGVGLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRI 532
            ||.|.              ||......|.....:...||.:|:.||.||||||||||||.|.||:
Mouse   176 NSCAT--------------SGENCEDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRV 226

  Fly   533 EIANTLQLNETQVKIWFQNRRMKQKKRVK-EGLIPADILTQHSTSVISEKPPQQQQPQ--PPELQ 594
            |:||.|.|.|.|:||||||||||.||..| :|::       ||        |..|.|:  ||   
Mouse   227 EMANLLNLTERQIKIWFQNRRMKYKKDQKAKGIL-------HS--------PAGQSPERSPP--- 273

  Fly   595 LKSQGSDLGGNE--------------LATGAPSTPTTAMT---------LTAPTS 626
                   |||..              ||..|||.|..|.:         .|||.|
Mouse   274 -------LGGAAGHVAYSGQLPPVPGLAYDAPSPPAFAKSQPNMYGLAAYTAPLS 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 37/51 (73%)
Hoxd3NP_034598.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..198 53/337 (16%)
Antp-type hexapeptide 161..166 1/4 (25%)
Homeobox 199..251 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..280 11/46 (24%)
DUF4074 370..431 CDD:290032
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.