DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Hoxd1

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_034597.2 Gene:Hoxd1 / 15429 MGIID:96201 Length:328 Species:Mus musculus


Alignment Length:281 Identity:93/281 - (33%)
Similarity:119/281 - (42%) Gaps:115/281 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 HHQNSVSPNGGMNRQQRGGVI-----SPGSSTSSSTSASNGAHPASTQSKSP---------NHSS 387
            |:..|...:||.:....|.|.     .||...:.....::| ||...|:.||         :.:|
Mouse   133 HYATSAVFSGGGSFLLSGQVDFAAFGEPGPFPACLKEPADG-HPGPFQTVSPAPGACPKPASPTS 196

  Fly   388 SIP----TYKWMQLKRNVPKPQAPKLPASGIASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGG 448
            |:|    |::||::|||.||.          :.:.:|                           |
Mouse   197 SLPAAHSTFEWMKVKRNAPKK----------SKLSEY---------------------------G 224

  Fly   449 NGSPGIGGVLSVQNSLIMANSAAAAGSAHPNGMGVGLGSGSGLSSCSLSSNTNNSGRTNFTNKQL 513
            ..||                         |:.:                       ||||:.|||
Mouse   225 ATSP-------------------------PSAI-----------------------RTNFSTKQL 241

  Fly   514 TELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVKEGLIP-----ADI-LTQ 572
            ||||||||||:||||||||||||.||||:|||||||||||||||||.:|||:.     |.| |.:
Mouse   242 TELEKEFHFNKYLTRARRIEIANCLQLNDTQVKIWFQNRRMKQKKREREGLLATAASVASIKLPR 306

  Fly   573 HSTSVISE-----KPPQQQQP 588
            ..||.|..     .|.|.|:|
Mouse   307 SETSPIKSGRNLGSPSQAQEP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 46/51 (90%)
Hoxd1NP_034597.2 PRK04233 59..>105 CDD:305134
Antp-type hexapeptide 204..209 2/4 (50%)
Homeobox 233..285 CDD:278475 46/51 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..328 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6687
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43494
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45946
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2567
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.