DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Hoxc6

DIOPT Version :10

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_006520531.1 Gene:Hoxc6 / 15425 MGIID:96197 Length:243 Species:Mus musculus


Alignment Length:81 Identity:45/81 - (55%)
Similarity:50/81 - (61%) Gaps:12/81 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 PNGMGVGLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNE 542
            |..:|||.|:            ....||..::..|..||||||||||||||.|||||||.|.|.|
Mouse   138 PGSLGVGYGA------------DRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTE 190

  Fly   543 TQVKIWFQNRRMKQKK 558
            .|:||||||||||.||
Mouse   191 RQIKIWFQNRRMKWKK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeodomain 505..558 CDD:459649 37/52 (71%)
Hoxc6XP_006520531.1 Homeodomain 150..206 CDD:459649 38/55 (69%)

Return to query results.
Submit another query.