DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Hoxc5

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_783857.1 Gene:Hoxc5 / 15424 MGIID:96196 Length:222 Species:Mus musculus


Alignment Length:276 Identity:80/276 - (28%)
Similarity:115/276 - (41%) Gaps:70/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 LANNPHQQQPQVQQQQQQPHQQPQHPQNQSPAAHQQHHQNSVSPNGGMNRQQRGGVISPGSSTSS 365
            :||:.::|.|.:      |....|...|...|:..|..:...   ||::........:|.:|...
Mouse     5 VANSFYKQSPNI------PAYNMQTCGNYGSASEVQASRYCY---GGLDLSITFPPPAPSNSLHG 60

  Fly   366 STSASN-GAH---PASTQSKSPNHSSSIPTYKWMQLKRNVPKPQAPKL---PASGIASMHDYQMN 423
            ...|:| .||   ||.:.:.:|.|:          |.|:...|..|.:   .|:..|.....:.:
Mouse    61 VDMAANPRAHPDRPACSAAAAPGHA----------LGRDEAAPLNPGMYSQKAARPALEERAKSS 115

  Fly   424 GQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSAHPNGMGVGLGSG 488
            |::...:...|..:|:...|                            |....:|          
Mouse   116 GEIKEEQAQTGQPAGLSQPP----------------------------APPQIYP---------- 142

  Fly   489 SGLSSCSLSSNTNNS-GRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNR 552
             .::...:|..|:.. .||::|..|..||||||||||||||.|||||||.|.|||.|:|||||||
Mouse   143 -WMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNR 206

  Fly   553 RMKQKK----RVKEGL 564
            |||.||    :.||.|
Mouse   207 RMKWKKDSKMKSKEAL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 40/51 (78%)
Hoxc5NP_783857.1 COG5373 65..>142 CDD:227665 18/114 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 17/110 (15%)
Antp-type hexapeptide 140..145 1/15 (7%)
Homeobox 158..212 CDD:395001 40/53 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.