DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Hoxb7

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_034590.2 Gene:Hoxb7 / 15415 MGIID:96188 Length:217 Species:Mus musculus


Alignment Length:224 Identity:69/224 - (30%)
Similarity:86/224 - (38%) Gaps:64/224 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 VISPGS--STSSSTSASNGAHPASTQSKSPNHSSSIPTYKWMQLKRNVPKPQAPKLPASGIASMH 418
            |.:||:  ..:|...|||...|..........|:|:                      .|:.|  
Mouse    20 VFAPGAFPEQTSCAFASNPQRPGYGAGPGAPFSASV----------------------QGLYS-- 60

  Fly   419 DYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNG---------------SPGIGGVLSVQNSLIMAN 468
                           |||:..|....||...|               ...:.||..       .:
Mouse    61 ---------------GGGAMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCP-------GD 103

  Fly   469 SAAAAGSAHPNGMGVGLGSGSGLSSCSLSSNTNNS-GRTNFTNKQLTELEKEFHFNRYLTRARRI 532
            .|.|||:.......:...|...:.....||..:.. ||..:|..|..|||||||:||||||.|||
Mouse   104 PAKAAGAKEQRDSDLAAESNFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRI 168

  Fly   533 EIANTLQLNETQVKIWFQNRRMKQKKRVK 561
            |||:||.|.|.|:||||||||||.||..|
Mouse   169 EIAHTLCLTERQIKIWFQNRRMKWKKENK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 37/51 (73%)
Hoxb7NP_034590.2 Antp-type hexapeptide 126..131 0/4 (0%)
Homeobox 141..194 CDD:365835 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..217 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.