DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Hoxb3

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus


Alignment Length:382 Identity:121/382 - (31%)
Similarity:147/382 - (38%) Gaps:123/382 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 AAVLHASYA--PGMVLEDQD----PMMQQATQSQMWHHQQHLAGSYALDA--MDSLGMHAHMHHG 292
            ||.|...|:  ||......|    |..|.||         ||.|.|...|  :.|||      :.
Mouse    11 AAALFGGYSSYPGSNGFGYDGPPQPPFQAAT---------HLEGDYQRSACSLQSLG------NA 60

  Fly   293 LPHGHLGNLANNPHQQQPQVQQQQQQPHQQPQHPQNQSPAAHQQHHQNSVSPNGGMNRQQRGGVI 357
            .||.....|  |....:|.:     .|...|..|.:..|:|                        
Mouse    61 APHAKSKEL--NGSCMRPGL-----APEPLPAPPGSPPPSA------------------------ 94

  Fly   358 SPGSSTSSSTSASNGAHPA-STQSKSPNHSSSIPT---YKWMQLKRNVPKPQAPKLPASGIASMH 418
            :|.|:||:|   :||..|: |...|....|:|..|   :.||:..|     |..||..|.     
Mouse    95 APTSTTSNS---NNGGGPSKSGPPKCGAGSNSTLTKQIFPWMKESR-----QTSKLKNSS----- 146

  Fly   419 DYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSAHPNGMGV 483
                .|..:.|.||||||.|.|.     ||.||.|.||                           
Mouse   147 ----PGTAEGCGGGGGGGGGGGG-----GGGGSSGGGG--------------------------- 175

  Fly   484 GLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIW 548
              |.|.|.......|..:...||.:|:.||.||||||||||||.|.||:|:||.|.|:|.|:|||
Mouse   176 --GGGGGGDKSPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIW 238

  Fly   549 FQNRRMKQKKRVK-EGLI-------PADILTQ--HST----SVISEKPPQQQQPQPP 591
            |||||||.||..| :||.       ||....|  .||    :.:....|....|.||
Mouse   239 FQNRRMKYKKDQKAKGLASSSGGPSPAGSPPQPMQSTAGFMNALHSMTPSYDSPSPP 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 37/51 (73%)
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 20/94 (21%)
Antp-type hexapeptide 129..134 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 26/106 (25%)
Homeobox 195..248 CDD:365835 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 7/26 (27%)
DUF4074 369..431 CDD:372548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.