DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Hoxa5

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_034583.1 Gene:Hoxa5 / 15402 MGIID:96177 Length:270 Species:Mus musculus


Alignment Length:327 Identity:86/327 - (26%)
Similarity:111/327 - (33%) Gaps:119/327 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 DQDPMMQQATQSQMWHHQQHLAGSYALDAMD-SLGMHAHMHHGLPHGHLGNLANN---------- 304
            |...:.:|...|...|..::   .|..:.|| |:|.....|.|     .|..|.:          
Mouse    26 DHSSVSEQFRDSASMHSGRY---GYGYNGMDLSVGRSGSGHFG-----SGERARSYAAGASAAPA 82

  Fly   305 -PHQQQPQVQQQQQQPHQQPQHPQNQSPAAHQQHH--QNSVSPNGGMNRQQRGGVISPGSSTSSS 366
             |...||........|...|......||.: ..||  :||:..:.|.:.......||......::
Mouse    83 EPRYSQPATSTHSPPPDPLPCSAVAPSPGS-DSHHGGKNSLGNSSGASANAGSTHISSREGVGTA 146

  Fly   367 TSASNGAHPASTQSKSPNHSSSIP-----TYKWMQLKRNVPKPQAPKLPASGIASMHDYQMNGQL 426
            ::|...|..:|.|:.:.:..|..|     .|.||:           ||..|     ||       
Mouse   147 SAAEEDAPASSEQAGAQSEPSPAPPAQPQIYPWMR-----------KLHIS-----HD------- 188

  Fly   427 DMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSAHPNGMGVGLGSGSGL 491
                                      .|||                     |.|           
Mouse   189 --------------------------NIGG---------------------PEG----------- 195

  Fly   492 SSCSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQ 556
                      ...||.:|..|..||||||||||||||.||||||:.|.|:|.|:||||||||||.
Mouse   196 ----------KRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKW 250

  Fly   557 KK 558
            ||
Mouse   251 KK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 38/51 (75%)
Hoxa5NP_034583.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 20/100 (20%)
Antp-type hexapeptide 176..181 2/4 (50%)
Homeobox 199..252 CDD:333795 38/52 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.