DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Hoxa4

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_077326.1 Gene:Hoxa4 / 100912525 RGDID:2814 Length:285 Species:Rattus norvegicus


Alignment Length:310 Identity:92/310 - (29%)
Similarity:119/310 - (38%) Gaps:77/310 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 HGLPHGHLGNLANNPHQQQPQVQQQ--QQQPHQQPQHPQNQSPAAHQQHHQNSVSPNGGMNRQQR 353
            ||.|.|..|.:...|...:||....  ...||...|.|...:|.|.:..:...:.|         
  Rat    26 HGGPGGGDGGVGGGPGYPRPQSSPHLPAPNPHAARQTPAYYAPRAREPSYHGGLYP--------- 81

  Fly   354 GGVISPGSSTSSSTSASNGAHPA-STQSKSPN-HSSSIPTYKWMQLKRNVPKPQAPKLPASGIAS 416
                   :..::...|..||.|| ..||.:|. |.|              |.||.|..|.     
  Rat    82 -------APAAACPYACRGASPARPEQSPAPGAHPS--------------PAPQPPAPPR----- 120

  Fly   417 MHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSAHPNGM 481
                       .|..|       ...|....|..:|..        .|::|:.    |.|.|.|.
  Rat   121 -----------RCAPG-------PTTPAVATGGSAPAC--------PLLLADQ----GPAGPKGK 155

  Fly   482 GVGLGSGSGLSSCSLSSNTNNSG-----RTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLN 541
            ...:.........|..:.:.|.|     ||.:|.:|:.||||||||||||||.||||||:||.|:
  Rat   156 EPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLS 220

  Fly   542 ETQVKIWFQNRRMKQKKRVKEGLIPADILTQHSTSVISEKPPQQQQPQPP 591
            |.||||||||||||.||..|   :|...:...:.:.....||.:.|...|
  Rat   221 ERQVKIWFQNRRMKWKKDHK---LPNTKMRSSNPASAPAGPPGKAQTHSP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 40/51 (78%)
Hoxa4NP_077326.1 Homeobox 183..236 CDD:278475 40/52 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.