DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and hoxb1

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_004918719.1 Gene:hoxb1 / 100493290 XenbaseID:XB-GENE-485772 Length:304 Species:Xenopus tropicalis


Alignment Length:317 Identity:98/317 - (30%)
Similarity:120/317 - (37%) Gaps:135/317 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 HGLPHGHLGNLANNPHQQQPQVQQQQQQPHQQPQHPQNQSPAAHQQ--HHQNSVSPNG-GMNRQQ 352
            :|:| .||       |||.|....|............:.:|....|  .||...||:. |:..||
 Frog    59 NGVP-SHL-------HQQNPSYPPQPSAGVPYTNSLTSYTPQTCNQAYGHQAYASPDADGIYFQQ 115

  Fly   353 RGGVISPGSSTSSSTSASNGAHPASTQSKS----------------------------------- 382
            .....:.|::::|.:....||.|...|.:.                                   
 Frog   116 TAYCSNTGANSNSYSDGYCGAVPGPAQYQQHPYGQEHQGLLQAYHNPPSMLHEEKEPSCPSEQAL 180

  Fly   383 PNHSSSIPTYKWMQLKRNVPKPQAPKLPASGIASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGVG 447
            |||     |:.||::|||.||..|.                                   ||..|
 Frog   181 PNH-----TFDWMKVKRNPPKTTAK-----------------------------------PVDFG 205

  Fly   448 GNGSPGIGGVLSVQNSLIMANSAAAAGSAHPNGMGVGLGSGSGLSSCSLSSNTNNSGRTNFTNKQ 512
                      ||.|.:.|                                       |||||.||
 Frog   206 ----------LSTQQNTI---------------------------------------RTNFTTKQ 221

  Fly   513 LTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVKEGLIPADI 569
            |||||||||||:|||||||:|||.||:||||||||||||||||||||.:|||.|:.|
 Frog   222 LTELEKEFHFNKYLTRARRVEIAATLELNETQVKIWFQNRRMKQKKREREGLAPSAI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 46/51 (90%)
hoxb1XP_004918719.1 PTZ00395 <12..>147 CDD:185594 24/95 (25%)
Homeobox 214..267 CDD:365835 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003011
OrthoInspector 1 1.000 - - otm48654
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2567
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.