DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and Hoxb2

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_002727852.1 Gene:Hoxb2 / 100361765 RGDID:2319509 Length:355 Species:Rattus norvegicus


Alignment Length:293 Identity:84/293 - (28%)
Similarity:110/293 - (37%) Gaps:101/293 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 GSST----SSSTSASNGAHPASTQSKSPNHSSSIPTYKWMQLKRNVPKP-QAPKLPASGIASMHD 419
            |:||    .|...|.:|  ||.........:...|.:.||:.|::..|| |:...|:...:|:  
  Rat    60 GASTLQRPGSQKPAGDG--PALRPPPPLPVAPPAPEFPWMKEKKSAKKPSQSAATPSPAASSV-- 120

  Fly   420 YQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSAHPNGMGVG 484
                      |..|.|....|.|....||:||..:                              
  Rat   121 ----------RASGVGSPSDGPGLPESGGSGSRRL------------------------------ 145

  Fly   485 LGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWF 549
                                ||.:||.||.|||||||||:||.|.||:|||..|.|.|.|||:||
  Rat   146 --------------------RTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWF 190

  Fly   550 QNRRMKQKKRVKE---------GLI-------PADILTQHSTSVISEK-------PPQQQQ---- 587
            ||||||.|::.:.         ||.       ||:..|.....|.|.:       |.:..|    
  Rat   191 QNRRMKHKRQTQHREPPDGEPGGLSAQDDAGEPAEEPTVSPGDVASHRLREACFLPAEAAQGPRG 255

  Fly   588 ---PQPPELQLKSQGSDLGGNEL--ATGAPSTP 615
               |.||...|:|.|:...|..:  |.|..|.|
  Rat   256 APPPLPPATALESVGASSPGCTMLRAGGLQSEP 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 37/51 (73%)
Hoxb2XP_002727852.1 Homeobox 146..198 CDD:278475 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.