DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and hoxb2

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_012808332.1 Gene:hoxb2 / 100038155 XenbaseID:XB-GENE-478525 Length:340 Species:Xenopus tropicalis


Alignment Length:281 Identity:79/281 - (28%)
Similarity:105/281 - (37%) Gaps:93/281 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 ISPGSST----SSSTSASNGAHPASTQSKSPNHSSSIPTYKWMQLKRNVPKPQAPKLPASGIASM 417
            ::|||.:    .|...|.||.  .......|.|.::  .:.||:.|::..|              
 Frog    54 LNPGSDSQIRPKSQKRAENGL--LQQPQVQPGHLAT--EFPWMKEKKSAKK-------------- 100

  Fly   418 HDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSAHPNGMG 482
                                         ...|||         .:||....:|....|.|.|:.
 Frog   101 -----------------------------SSQGSP---------QALIPPPESAGGSPAEPPGLH 127

  Fly   483 VGLGSGSGLSSCSLSSNTNNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKI 547
            ...|....|             ||.:||.||.|||||||||:||.|.||:|||..|.|.|.|||:
 Frog   128 DAGGGSRRL-------------RTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKV 179

  Fly   548 WFQNRRMKQKKRVKEGLIPADILTQHSTSVISE---KPPQQQQP--QPPELQLKSQGSDLGGNEL 607
            ||||||||.|::           |||..|...|   ..|:..:|  ...:..:..||.|...:..
 Frog   180 WFQNRRMKHKRQ-----------TQHKDSQDGEHSYSNPEDGEPLDDGDDSPVYHQGLDSNDSLR 233

  Fly   608 ATGAPSTPTTAMTLTAPTSKQ 628
            .......|:|||    |:||:
 Frog   234 EQEIRKDPSTAM----PSSKE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 37/51 (73%)
hoxb2XP_012808332.1 Homeobox 137..190 CDD:365835 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.