DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lab and hoxa2

DIOPT Version :9

Sequence 1:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_004915456.1 Gene:hoxa2 / 100038099 XenbaseID:XB-GENE-488087 Length:373 Species:Xenopus tropicalis


Alignment Length:231 Identity:73/231 - (31%)
Similarity:92/231 - (39%) Gaps:100/231 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 SSTSSST-----------SASNGAHPASTQSK-SPN-HSSS-------IPTYKWMQLKRNVPKPQ 405
            |:.|.||           |.:.|:||..::.| ||| |..|       .|.|.||:.|:...|  
 Frog    40 SALSHSTLIPPPFEQTIPSLNPGSHPRHSRPKHSPNGHGDSPVPAGSLPPEYPWMKEKKASKK-- 102

  Fly   406 APKLPASGIASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSA 470
            ||                                                         |.|.:|
 Frog   103 AP---------------------------------------------------------IAAATA 110

  Fly   471 AAAGSAHPNGMGVGLGSGSGLSSC-----SLSSNTNNSG-----RTNFTNKQLTELEKEFHFNRY 525
            |||.||.|           ..::|     .:....|:||     ||.:||.||.|||||||||:|
 Frog   111 AAAASAAP-----------ATTACLSHKEIIEIQDNSSGGSRRLRTAYTNTQLLELEKEFHFNKY 164

  Fly   526 LTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVK 561
            |.|.||:|||..|.|.|.|||:||||||||.|::.:
 Frog   165 LCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
labNP_476613.1 Homeobox 505..557 CDD:278475 37/51 (73%)
hoxa2XP_004915456.1 Homeobox 144..197 CDD:365835 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.