DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment agt and MGT1

DIOPT Version :9

Sequence 1:NP_001303422.1 Gene:agt / 40816 FlyBaseID:FBgn0024912 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_010081.2 Gene:MGT1 / 851327 SGDID:S000002359 Length:188 Species:Saccharomyces cerevisiae


Alignment Length:95 Identity:42/95 - (44%)
Similarity:60/95 - (63%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SQAIPIA-IYGTDFQLSVWRALVHMKRGETCTYSQLAERMGRPTAVRAVASAVAKNELAILIPCH 164
            |.|||.. ::|||||..||..|::::.|...||..:|:|:|:|||.|:|..|...|.||:|:|||
Yeast    88 SGAIPFEFLFGTDFQRKVWNELLNVEHGHVVTYGDIAKRIGKPTAARSVGRACGSNNLALLVPCH 152

  Fly   165 RVVSQN-GASKYHWGAALKQLLLADEKSKN 193
            |:|..| ..:.|.|...||:.||.:||..:
Yeast   153 RIVGSNRKLTGYKWSCKLKEQLLNNEKENS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
agtNP_001303422.1 AdaB 22..190 CDD:223427 40/90 (44%)
ATase 111..189 CDD:392118 35/78 (45%)
MGT1NP_010081.2 AdaB 5..179 CDD:223427 40/90 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345212
Domainoid 1 1.000 79 1.000 Domainoid score I2049
eggNOG 1 0.900 - - E1_COG0350
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3428
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004341
OrthoInspector 1 1.000 - - oto99530
orthoMCL 1 0.900 - - OOG6_101199
Panther 1 1.100 - - LDO PTHR10815
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2186
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.680

Return to query results.
Submit another query.