DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment agt and mgmt

DIOPT Version :9

Sequence 1:NP_001303422.1 Gene:agt / 40816 FlyBaseID:FBgn0024912 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001243172.1 Gene:mgmt / 553368 ZFINID:ZDB-GENE-120614-1 Length:192 Species:Danio rerio


Alignment Length:158 Identity:43/158 - (27%)
Similarity:79/158 - (50%) Gaps:26/158 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ISGDSKDQVAIGVLHFVIKDNVSTYNEVQERWPKSELWKDDDAVKLVADKLFESDKENSQAIPI- 106
            ::.|.::.|:...:|.|:...:|           |||.:..|.:     :.:..:.|:..|:|: 
Zfish    37 LNTDKEESVSCCSVHPVVLSEMS-----------SELQRCVDWL-----QCYFMNPESISALPLP 85

  Fly   107 -----AIYGTDFQLSVWRALV-HMKRGETCTYSQLAERMGRPTAVRAVASAVAKNELAILIPCHR 165
                 .:....|:..|.:.|: .:..|:|.:|.||||.:|.|.|||||.||:.:|.:.:::||||
Zfish    86 ALHHPLMQSDSFKAQVLKTLLKEVGVGKTVSYKQLAEMIGNPNAVRAVGSAMKQNPVPLIVPCHR 150

  Fly   166 VVSQNGASKYHWGAA---LKQLLLADEK 190
            |:..:|.:..:.|..   :|..||..|:
Zfish   151 VLLSSGHTGSYMGGKGDDIKVWLLTHER 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
agtNP_001303422.1 AdaB 22..190 CDD:223427 42/156 (27%)
ATase 111..189 CDD:392118 30/81 (37%)
mgmtNP_001243172.1 Methyltransf_1N 13..93 CDD:280944 12/71 (17%)
PRK00901 16..178 CDD:234860 42/156 (27%)
ATase 97..178 CDD:119438 30/80 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590301
Domainoid 1 1.000 57 1.000 Domainoid score I10920
eggNOG 1 0.900 - - E1_COG0350
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1573162at2759
OrthoFinder 1 1.000 - - FOG0004341
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101199
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2186
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.640

Return to query results.
Submit another query.