DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment agt and mgmt

DIOPT Version :9

Sequence 1:NP_001303422.1 Gene:agt / 40816 FlyBaseID:FBgn0024912 Length:194 Species:Drosophila melanogaster
Sequence 2:XP_017950857.1 Gene:mgmt / 496878 XenbaseID:XB-GENE-941688 Length:200 Species:Xenopus tropicalis


Alignment Length:82 Identity:37/82 - (45%)
Similarity:47/82 - (57%) Gaps:4/82 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 FQLSVWRALVH-MKRGETCTYSQLAERMGRPTAVRAVASAVAKNELAILIPCHRVVSQNGASKYH 176
            |..:|..||:. :|.|||.:|.:||...|...|||||..|:..|.:.||||||||:..||:...:
 Frog   114 FTKAVLMALLQKVKFGETVSYKELAVMAGNEKAVRAVGGAMRNNPVPILIPCHRVICSNGSVGNY 178

  Fly   177 WGA---ALKQLLLADEK 190
            .|.   .||..|||.||
 Frog   179 IGGKGNQLKPWLLAHEK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
agtNP_001303422.1 AdaB 22..190 CDD:223427 35/80 (44%)
ATase 111..189 CDD:392118 35/79 (44%)
mgmtXP_017950857.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10612
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1573162at2759
OrthoFinder 1 1.000 - - FOG0004341
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2186
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.