DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment agt and atl1

DIOPT Version :9

Sequence 1:NP_001303422.1 Gene:agt / 40816 FlyBaseID:FBgn0024912 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_594858.1 Gene:atl1 / 2541704 PomBaseID:SPAC1250.04c Length:108 Species:Schizosaccharomyces pombe


Alignment Length:60 Identity:17/60 - (28%)
Similarity:30/60 - (50%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 DFQLSVWRALVHMKRGETCTYSQLAERMGRPTAVRAVASAVAKNELAILIPCHRVVSQNG 171
            :|...|:.|:..:..|:..||.::|..:|.|:..|.|..|:........:|.|||::..|
pombe     5 EFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRG 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
agtNP_001303422.1 AdaB 22..190 CDD:223427 17/60 (28%)
ATase 111..189 CDD:392118 17/60 (28%)
atl1NP_594858.1 Atl1 1..108 CDD:226219 17/60 (28%)
AdaB <5..87 CDD:223427 17/60 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0350
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004341
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101199
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2186
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.