powered by:
Protein Alignment agt and atl1
DIOPT Version :9
Sequence 1: | NP_001303422.1 |
Gene: | agt / 40816 |
FlyBaseID: | FBgn0024912 |
Length: | 194 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_594858.1 |
Gene: | atl1 / 2541704 |
PomBaseID: | SPAC1250.04c |
Length: | 108 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 60 |
Identity: | 17/60 - (28%) |
Similarity: | 30/60 - (50%) |
Gaps: | 0/60 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 DFQLSVWRALVHMKRGETCTYSQLAERMGRPTAVRAVASAVAKNELAILIPCHRVVSQNG 171
:|...|:.|:..:..|:..||.::|..:|.|:..|.|..|:........:|.|||::..|
pombe 5 EFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRG 64
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0350 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004341 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_101199 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2186 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.740 |
|
Return to query results.
Submit another query.